
Welcome to Suzhou Strong Pipeline Anticorrosive Materials Co., Ltd!
Heat shrinkable sleeve





Contact: Cheng Huijiang

Cheng Huijiang: 13806256210

Tel: 0512-63982510

Fax: 0512-63982520

Address: Wujiang District, Suzhou City, 

Jiangsu Province, Fenghai town Jin Jinba Road, 333

Website: www.diendanthanhly.net

Heat shrinkable tape with semi - finished products

Your current location: Home >> Products >> Heat shrinkable

Heat shrinkable tape with semi - finished products


The heat-shrinkable tape series is designed for the preservation of insulation and insulation pipes for buried and overhead steel pipe welds. It is composed of radiation cross-linked polyolefin substrate and special sealed hot melt compound, special sealed hot melt and polyolefin substrate, steel pipe surface and solid epoxy coating can form a good bond. WK-WT heat shrinkable tape in the heating installation, the substrate in the radial contraction at the same time, the internal composite layer melting, tightly wrapped in the mouth, together with the substrate in the pipeline outside the formation of a solid anti-corrosion body , With excellent wear resistance, corrosion resistance, impact resistance and good anti-ultraviolet and light aging performance. Mainly used for elbow, straight pipe full anti-corrosion, tee, flange and other parts.

Related tags:Heatshrinkableanticorrosivematerialseries,heatshrinktapewithsemi-finishedproductprice,heatshrinktapewithsemi-finishedproductwholesale

Recently Viewed:

related news:

Welcome to leave a message to us
Please enter your message here and we will contact you as soon as possible.